missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98442

Invitrogen™ Human Viperin (aa 265-361) Control Fragment Recombinant Protein

Catalog No. RP98442
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98442 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98442 Supplier Invitrogen™ Supplier No. RP98442

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59457 (PA5-59457. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Viperin is a 43kDa protein which is one of several hundred interferon inducible viral proteins. Elevated expression of viperin is induced by LPS and poly I:C through TLR dependent signaling pathways. Sendai virus mediated viperin expression is induced independently of TLR signaling pathways through RLRs - RIG-I and MAVs (Severa, 2006). Viperin has been shown to play an important role in interferon mediated anti-viral activity in a Hepatitis C virus model system (Helbig, 2011). Viperin is induced in lymphoid cells and dendritic cells (DCs) and highly induced in neutrophils and macrophages during acute LCMV infection in mice (Hinson, ). Viperin functions as a mediator of viral resistance and as a marker for interferon responsiveness making its detection and mechanism of action through specific antibody probes valuable for further studies.

Specifications

Accession Number Q8WXG1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 91543
Name Human Viperin (aa 265-361) Control Fragment
Quantity 100 μL
Gene Alias 2510004L01Rik; Best5; Bone-expressed sequence tag 5 protein; cig33; cig5; CIG6; cytomegalovirus-induced gene 5 protein; hypothetical protein LOC570456; inflammatory response gene 6 protein; inflammatory response protein 6; IRG6; radical S-adenosyl methionine domain containing 2; radical S-adenosyl methionine domain-containing protein 2; rsad2; rsad2 {ECO:0000250; si:ch211-276e8.2; similar to radical S-adenosyl methionine domain containing 2; UniProtKB:Q8WXG1}; VHSV-induced-like protein; Vig1; Viperin; viral hemorrhagic septicemia virus (VHSV)-induced gene 1; virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible; zgc:112342
Common Name Viperin
Gene Symbol Rsad2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less