missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human VGF (aa 514-610) Control Fragment Recombinant Protein

Catalog No. RP101768
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101768 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101768 Supplier Invitrogen™ Supplier No. RP101768

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63081. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VGF was initially identified as a rapidly regulated gene product in nerve growth factor-treated PC12 cells. This protein is synthesized in neurons in the central and peripheral nervous system as well as in the pituitary, adrenal medulla, endocrine cells of the stomach, and pancreatic beta cells. VGF is thought to be involved in organism energy balance and regulation of homeostasis as mice lacking this gene show deficits in these areas. More recent results suggest that VGF is upregulated by brain-derived neurotrophic factor (BDNF) and can stimulate the proliferation of hippocampal progenitor cells and produce antidepressant-like behavioral effects, suggesting that this pathway may be a suitable target for therapeutic treatments.

Specifications

Accession Number O15240
Concentration 2.5 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 7425
Name Human VGF (aa 514-610) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias Antimicrobial peptide VGF[554-577]; Gm1052; NERP-1; NERP-2; Neuroendocrine regulatory peptide-1; Neuroendocrine regulatory peptide-2; neuro-endocrine specific protein VGF; Neurosecretory protein VGF; SCG7; SgVII; Vgf; VGF nerve growth factor inducible; VGF(180-194); VGF(24-63); VGF(375-407); VGF8a protein; VGF-derived peptide AQEE-30; VGF-derived peptide HFHH-10; VGF-derived peptide LQEQ-19; VGF-derived peptide TLQP-11; VGF-derived peptide TLQP-21; VGF-derived peptide TLQP-30; VGF-derived peptide TLQP-62
Common Name VGF
Gene Symbol VGF
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence APARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRPRTLQPPSALRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQEELENYIEHV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less