missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human VGF (aa 514-610) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101768
Description
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63081 (PA5-63081. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
VGF was initially identified as a rapidly regulated gene product in nerve growth factor-treated PC12 cells. This protein is synthesized in neurons in the central and peripheral nervous system as well as in the pituitary, adrenal medulla, endocrine cells of the stomach, and pancreatic beta cells. VGF is thought to be involved in organism energy balance and regulation of homeostasis as mice lacking this gene show deficits in these areas. More recent results suggest that VGF is upregulated by brain-derived neurotrophic factor (BDNF) and can stimulate the proliferation of hippocampal progenitor cells and produce antidepressant-like behavioral effects, suggesting that this pathway may be a suitable target for therapeutic treatments.Specifications
| O15240 | |
| Blocking Assay, Control | |
| 7425 | |
| 100 μL | |
| Antimicrobial peptide VGF[554-577 ]; Gm1052; NERP-1; NERP-2; Neuroendocrine regulatory peptide-1; Neuroendocrine regulatory peptide-2; neuro-endocrine specific protein VGF; Neurosecretory protein VGF; SCG7; SgVII; Vgf; VGF nerve growth factor inducible; VGF(180-194); VGF(24-63); VGF(375-407); VGF8a protein; VGF-derived peptide AQEE-30; VGF-derived peptide HFHH-10; VGF-derived peptide LQEQ-19; VGF-derived peptide TLQP-11; VGF-derived peptide TLQP-21; VGF-derived peptide TLQP-30; VGF-derived peptide TLQP-62 | |
| VGF | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human VGF (aa 514-610) Control Fragment | |
| RUO | |
| VGF | |
| Unconjugated | |
| Recombinant | |
| APARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRPRTLQPPSALRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQEELENYIEHV | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |