missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96649

Invitrogen™ Human UTP3 (aa 176-263) Control Fragment Recombinant Protein

Catalog No. RP96649
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96649 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96649 Supplier Invitrogen™ Supplier No. RP96649
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57354 (PA5-57354. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Essential for gene silencing: has a role in the structure of silenced chromatin. Plays a role in the developing brain. [UniProt]

Specifications

Accession Number Q9NQZ2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57050
Name Human UTP3 (aa 176-263) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2400011K09Rik; AW557551; C87704; charged amino acid rich leucine zipper 1; charged amino acid rich leucine zipper 1 homolog; charged amino acid-rich leucine zipper 1; Crl1; Crl-1; Crlz1; disrupter of silencing 10; disrupter of silencing SAS10; Sas10; something about silencing protein 10; UTP3; UTP3 homolog; UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae); UTP3, small subunit processome component; UTP3, small subunit processome component homolog (S. cerevisiae)
Common Name UTP3
Gene Symbol Utp3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less