missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP92684

Invitrogen™ Human URG4 (aa 404-527) Control Fragment Recombinant Protein

Catalog No. RP92684
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92684 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92684 Supplier Invitrogen™ Supplier No. RP92684
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54158 (PA5-54158. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The specific function of this protein remains unknown. URG4 is upregulated in the presence of hepatitis B virus (HBV)-encoded X antigen (HBxAg) and may contribute to the development of hepatocellular carcinoma by promoting hepatocellular growth and survival (Tufan et al., 2002 ).

Specifications

Accession Number Q8TCY9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55665
Name Human URG4 (aa 404-527) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010005J08Rik; 9130001I21Rik; AW060359; DKFZp666G166; DKFZp686O0457; HBV x protein up-regulated gene 4 protein; HBV x protein up-regulated gene 4 protein homolog; HBxAg up-regulated gene 4 protein; HBxAg up-regulated gene 4 protein homolog; KIAA1507; mKIAA1507; protein URG4; RGD1564681; up-regulated gene 4; upregulator of cell proliferation; up-regulator of cell proliferation; URG4; Urgcp
Common Name URG4
Gene Symbol URGCP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LIPVLKIDHSHVLVKVSSTDSDSFVKRIRAIVGNVLRAPCRRVSVEDMAHAARKLGLKVDEDCEECQKAKDRMERITRKIKDSDAYRRDELRLQGDPWRKAAQVEKEFCQLQWAVDPPEKHRAE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less