missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human URB1 (aa 1571-1680) Control Fragment Recombinant Protein

Catalog No. RP91808
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91808 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91808 Supplier Invitrogen™ Supplier No. RP91808

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53787 (PA5-53787. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

URB1 gene ontology annotations related to this gene include maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA); maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA).

Specifications

Accession Number O60287
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9875
Name Human URB1 (aa 1571-1680) Control Fragment
Quantity 100 μL
Gene Alias 4921511H13Rik; 5730405K23Rik; AA670781; AI645590; C21orf108; KIAA0539; mKIAA0539; NOP254; NPA1; nucleolar pre-ribosomal-associated protein 1; nucleolar preribosomal-associated protein 1; nucleolar protein 254 kDa; Protein URB1; URB1; URB1 ribosome biogenesis 1 homolog; URB1 ribosome biogenesis 1 homolog (S. cerevisiae)
Common Name URB1
Gene Symbol URB1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VEHHKTCRSLGRSLWQQPSVGDILRLLDRDRMMQTILHFPQNRRLLPPEDTQELIFKDKSRVDLDGLYDPCFLLQLFSELTRPEFVVDCRKFLDSNALGLTVTALSSYDP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less