missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98373

Invitrogen™ Human UNC119 (aa 52-93) Control Fragment Recombinant Protein

Catalog No. RP98373
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98373 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98373 Supplier Invitrogen™ Supplier No. RP98373

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59781 (PA5-59781. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is specifically expressed in the photoreceptors in the retina. The encoded product shares strong homology with the C. elegans unc119 protein and it can functionally complement the C. elegans unc119 mutation. It has been localized to the photoreceptor synapses in the outer plexiform layer of the retina, and suggested to play a role in the mechanism of photoreceptor neurotransmitter release through the synaptic vesicle cycle. Two transcript variants encoding different isoforms have been described for this gene.

Specifications

Accession Number Q13432
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9094
Name Human UNC119 (aa 52-93) Control Fragment
Quantity 100 μL
Gene Alias CRG4; D11Bhm52; hRG4; IMD13; MRG4; POC7; POC7 centriolar protein homolog A; POC7A; Protein unc-119 homolog A; retinal gene 4; retinal protein 4; Rg4; RRG4; Rtg4; Unc119; unc-119 homolog; UNC-119 homolog (C. elegans); unc-119 lipid binding chaperone; Unc119h; Uncl19
Common Name UNC119
Gene Symbol UNC119
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less