missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human UFD1L (aa 111-196) Control Fragment Recombinant Protein

Catalog No. RP95339
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95339 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95339 Supplier Invitrogen™ Supplier No. RP95339

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56427 (PA5-56427. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ubiquitin-mediated proteolysis requires the transfer of ubiquitin (Ub) to lysine groups on selected cellular proteins, which then potentiates the proteolytic degradation of these protein conjugates by the 26S proteasome. Ub-fusions are cleaved by Ub-specific processing proteases (UBps) or alternatively by the Ub-fusion degradation (UFD) pathway. The UBP pathway targets the C-terminal glycine residue on Ub that is involved in the formation of Ub-conjugates, while UFD proteins preferentially cleave Ub-conjugated proteins that contain an amino acid substitution at this glycine residue. The UFD1 protein was originally characterized in the yeast S. cerevisiae and subsequently, the human homolog UFD1 or UFD1L was identified. In vitro, UFD1 attenuates the degradation of Ub-fusions, which have a proline or valine residue substituted at the Gly76 moiety, by the selective multiubiquitination of the Ub chain of the Ub-conjugate. Mutations within the UFD1 gene are implicated in the development of CATCH22 syndrome, which is characterized by cardiac defects, cleft palate and hypocalcemia, suggesting that this proteolytic pathway may be involved in the progression of these developmental defects.

Specifications

Accession Number Q92890
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7353
Name Human UFD1L (aa 111-196) Control Fragment
Quantity 100 μL
Gene Alias RGD:619822}; UB fusion protein 1; UB fusion protein 1 {ECO:0000250; ubiquitin fusion degradation 1 like; ubiquitin fusion degradation 1 like (yeast); Ubiquitin fusion degradation protein 1; Ubiquitin fusion degradation protein 1 homolog; ubiquitin fusion degradation protein 1 homolog {ECO:0000250; Ubiquitin recognition factor in ER-associated degradation protein 1; UFD1; UFD1L; ufd1l {ECO:0000312; UniProtKB:Q92890}
Common Name UFD1L
Gene Symbol UFD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less