missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91895

Invitrogen™ Human UBE1 (aa 940-1051) Control Fragment Recombinant Protein

Catalog No. RP91895
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91895 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91895 Supplier Invitrogen™ Supplier No. RP91895
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81869 (PA5-81869. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UBE1 catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11. 23. Alternative splicing results in 2 transcript variants encoding the same protein, but with different 5' UTR.

Specifications

Accession Number P22314
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7317
Name Human UBE1 (aa 940-1051) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A1S9; A1S9 protein; A1S9T; A1S9T and BN75 temperature sensitivity complementing; A1ST; AMC x 1; CFAP124; EMBL:AAH85791.1, ECO:0000312; GXP1; POC20; POC20 centriolar protein homolog; Protein A1S9; RGD:1359327}; Sbx; SMA x 2; testicular secretory protein Li 63; Uba1; uba1 {ECO:0000312; UBA1, ubiquitin-activating enzyme E1 homolog A; UBA1A; UBE1; Ube-1; Ube1ax; Ube1x; ubiquitin like modifier activating enzyme 1; Ubiquitin-activating enzyme E1; ubiquitin-activating enzyme E1 {ECO:0000250; Ubiquitin-activating enzyme E1 X; ubiquitin-activating enzyme E1, Chr X; ubiquitin-like modifier activating enzyme 1; ubiquitin-like modifier-activating enzyme 1; ubiquitin-like modifier-activating enzyme 1 {ECO:0000250; Ubiquitin-like modifier-activating enzyme 1 X; UniProtKB:Q02053}
Common Name UBE1
Gene Symbol UBA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less