missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human UBC13 (aa 8-40) Control Fragment Recombinant Protein

Catalog No. RP100033
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100033 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100033 Supplier Invitrogen™ Supplier No. RP100033

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83750 (PA5-83750. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains. This type of polyubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Acts together with the E3 ligases, HLTF and SHPRH, in the 'Lys-63'-linked poly-ubiquitination of PCNA upon genotoxic stress, which is required for DNA repair. Appears to act together with E3 ligase RNF5 in the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes. Together with RNF135 and UB2V1, catalyzes the viral RNA-dependent 'Lys-63'-linked polyubiquitination of RIG-I/DDX58 to activate the downstream signaling pathway that leads to interferon beta production. UBE2V1-UBE2N together with TRAF3IP2 E3 ubiquitin ligase mediate 'Lys-63'-linked polyubiquitination of TRAF6, a component of IL17A-mediated signaling pathway. (Uniprot)

Specifications

Accession Number P61088
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7334
Name Human UBC13 (aa 8-40) Control Fragment
Quantity 100 μL
Gene Alias 1500026J17Rik; AL022654; BB101821; bendless protein; bendless-like ubiquitin conjugating enzyme; bendless-like ubiquitin-conjugating enzyme; Blu; E2 ubiquitin-conjugating enzyme N; epididymis secretory protein Li 71; HEL-S-71; MGC131857; MGC8489; UBC13; UbcH13; UbcH-ben; UBCHBEN; UBC13; UBE2N; Ubiquitin carrier protein N; ubiquitin conjugating enzyme E2 N; ubiquitin conjugating enzyme E2N; ubiquitin-conjugating enzyme E2 N; ubiquitin-conjugating enzyme E2N; ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13); ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast); ubiquitin-protein ligase N; yeast UBC13 homolog
Common Name UBC13
Gene Symbol UBE2N
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IIKETQRLLAEPVPGIKAEPDESNARYFHVVIA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less