missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96360

Invitrogen™ Human UBA3 (aa 330-426) Control Fragment Recombinant Protein

Catalog No. RP96360
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96360 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96360 Supplier Invitrogen™ Supplier No. RP96360

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Specifications

Accession Number Q8TBC4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9039
Name Human UBA3 (aa 330-426) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A830034N06Rik; AI256736; AI848246; AW546539; DKFZp566J164; hUBA3; MGC22384; NAE2; NEDD8-activating enzyme E1 catalytic subuni-like protein; NEDD8-activating enzyme E1 catalytic subunit; NEDD8-activating enzyme E1 subunit 2; NEDD8-activating enzyme E1C; Nedd8-activating enzyme hUba3; Uba3; UBA3, ubiquitin-activating enzyme E1 homolog; UBE1C; ubiquitin like modifier activating enzyme 3; ubiquitin-activating enzyme 3; Ubiquitin-activating enzyme E1C; ubiquitin-activating enzyme E1C (homologous to yeast UBA3); ubiquitin-activating enzyme E1C (UBA3 homolog, yeast); ubiquitin-like modifier activating enzyme 3; ubiquitin-like modifier-activating enzyme 3; Unknown (protein for MGC:140052); wu:fb75e04; wu:fc37b11; zgc:55528
Common Name UBA3
Gene Symbol Uba3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less