missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP92636

Invitrogen™ Human TWISTNB (aa 167-249) Control Fragment Recombinant Protein

Catalog No. RP92636
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92636 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92636 Supplier Invitrogen™ Supplier No. RP92636

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54586 (PA5-54586. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA-directed RNA polymerase I subunit RPA43 or Twist neighbor protein (Twistnb)belongs to the eukaryotic RPA43 RNA polymerase subunit family. It catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.Twistnb is the component of RNA polymerase I which synthesizes ribosomal RNA precursors. It is widely expressed in all fetal and adult tissues, with highest expression in fetal lung, liver, and kidney, and low expression in all adult tissues. Twist genes are essential for embryonic development and are conserved from jellyfish to human.

Specifications

Accession Number Q3B726
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 221830
Name Human TWISTNB (aa 167-249) Control Fragment
Quantity 100 μL
Gene Alias 2410173G11; 2810024J17Rik; D16Wsu83e; DNA-directed RNA polymerase I subunit RPA43; POLR1F; RNA polymerase I subunit F; twist basic helix-loop-helix transcription factor 1 neighbor; TWIST neighbor; twist neighbor protein; TWISTNB
Common Name TWISTNB
Gene Symbol TWISTNB
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QTMEINMGDELEFEVFRLDSDAAGVFCIRGKLNITSLQFKRSEVSEEVTENGTEEAAKKPKKKKKKKDPETYEVDSGTTKLAD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less