missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TUSC1 (aa 138-208) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100015
Description
Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62408 (PA5-62408. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.Specifications
| Q2TAM9 | |
| Blocking Assay, Control | |
| 286319 | |
| 100 μL | |
| 2200001D17Rik; TSG9; TSG-9; tumor suppressor candidate 1; tumor suppressor candidate gene 1 protein; Tumor suppressor candidate gene 1 protein homolog; tumour suppressor candidate 1; TUSC1 | |
| TUSC1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TUSC1 (aa 138-208) Control Fragment | |
| RUO | |
| TUSC1 | |
| Unconjugated | |
| Recombinant | |
| TNRRARDSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPLQEPDSGLRSRDSEPS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |