missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TTLL3 (aa 598-671) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100007
Description
Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62403 (PA5-62403. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
TTLL3 gene ontology annotations related to this gene include protein polyglycylation.Specifications
| Q9Y4R7 | |
| Blocking Assay, Control | |
| 26140 | |
| 100 μL | |
| HOTTL; PRO0207; TTLL3; Tubulin monoglycylase TTLL3; tubulin tyrosine ligase like 3; tubulin tyrosine ligase-like family member 3; tubulin tyrosine ligase-like family, member 3; tubulin--tyrosine ligase-like protein 3 | |
| TTLL3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TTLL3 (aa 598-671) Control Fragment | |
| RUO | |
| TTLL3 | |
| Unconjugated | |
| Recombinant | |
| KLVGTKALSTTGKALRTLPTAKVFISLPPNLDFKVAPSILKPRKAPALLCLRGPQLEVPCCLCPLKSEQFLAPV | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |