missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TSPAN3 (aa 127-208) Control Fragment Recombinant Protein

Catalog No. RP91077
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91077 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91077 Supplier Invitrogen™ Supplier No. RP91077

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53408 (PA5-53408. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene. Two alternative transcripts encoding different isoforms have been described.

Specifications

Accession Number O60637
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10099
Name Human TSPAN3 (aa 127-208) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700055K04Rik; H41D4 protein; OAP-1; OSP-associated protein 1; tetraspan 3; tetraspan TM4SF; tetraspanin 3; tetraspanin TM4-A; tetraspanin TM4-A homolog; tetraspanin-3; TM4-A; Tm4sf8; Transmembrane 4 superfamily member 8; TSPAN3; TSPAN-3
Common Name TSPAN3
Gene Symbol TSPAN3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less