missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89414

Invitrogen™ Human TSHZ1 (aa 74-221) Control Fragment Recombinant Protein

Catalog No. RP89414
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89414 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89414 Supplier Invitrogen™ Supplier No. RP89414

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82271 (PA5-82271. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a colon cancer antigen that was defined by serological analysis of recombinant cDNA expression libraries. The encoded protein is a member of the teashirt C2H2-type zinc-finger protein family and may be involved in transcriptional regulation of developmental processes.

Specifications

Accession Number Q6ZSZ6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10194
Name Human TSHZ1 (aa 74-221) Control Fragment
Quantity 100 μL
Gene Alias 5730407I04Rik; antigen NY-CO-33; CAA; D18Bwg1409e; Kiaa4206; mKIAA4206; Mtsh1; NY-CO-33; SDCCAG33; Serologically defined colon cancer antigen 3 homolog; serologically defined colon cancer antigen 33; Teashirt homolog 1; teashirt zinc finger family member 1; teashirt zinc finger homeobox 1; teashirt1; TSH1; Tshz1
Common Name TSHZ1
Gene Symbol TSHZ1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSYPQDSLAQIKAVYANLFSESCWSSLALDLKKSGSTTSTNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTSCSSSTSHSSTTSTSSSSGYDWHQAALAKTLQQTSSYGLLPEPS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less