missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94557

Invitrogen™ Human TSEN15 Control Fragment Recombinant Protein

Catalog No. RP94557
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94557 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94557 Supplier Invitrogen™ Supplier No. RP94557

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56087 (PA5-56087. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3'-end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events.

Specifications

Accession Number Q8WW01
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 116461
Name Human TSEN15 Control Fragment
Quantity 100 μL
Gene Alias 5730449L18Rik; AL023077; C16H1ORF19; C1orf19; HsSEN15; PCH2F; RGD1308584; sen15; SEN15 homolog; tRNA splicing endonuclease 15 homolog; tRNA splicing endonuclease 15 homolog (S. cerevisiae); tRNA splicing endonuclease subunit 15; tRNA-intron endonuclease Sen15; tRNA-splicing endonuclease subunit Sen15; Tsen15; TSEN15 tRNA splicing endonuclease subunit; Unknown (protein for MGC:127982)
Common Name TSEN15
Gene Symbol Tsen15
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EERGDSEPTPGCSGLGPDGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATHVYVAFLVYLDLMESK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less