missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRPM1 (aa 1253-1365) Control Fragment Recombinant Protein

Catalog No. RP105731
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105731 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105731 Supplier Invitrogen™ Supplier No. RP105731
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110795 (PA5-110795. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is similar to the transient receptor potential (Trp) calcium channel family members. The expression of this protein is inversely correlated with melanoma aggressiveness, suggesting that it suppresses melanoma metastasis.

Specifications

Accession Number Q7Z4N2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4308
Name Human TRPM1 (aa 1253-1365) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4732499L03Rik; AI606771; CSNB1C; EMBL:CAI30141.1}; long transient receptor potential channel 1; Ltrpc1; melastatin; melastatin 1; melastatin-1; MLSN; MLSN1; transient receptor potential cation channel subfamily M member 1; transient receptor potential cation channel, subfamily M, member 1; transient receptor potential melastatin family; Trpm1; trpm1 {ECO:0000312
Common Name TRPM1
Gene Symbol TRPM1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CEATYLLRQSSINSADGYSLYRYHFNGEELLFEDTSLSTSPGTGVRKKTCSFRIKEEKDVKTHLVPECQNSLHLSLGTSTSATPDGSHLAVDDLKNAEESKLGPDIGISKEDD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less