missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP99311

Invitrogen™ Human TRPC4AP (aa 427-511) Control Fragment Recombinant Protein

Catalog No. RP99311
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99311 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99311 Supplier Invitrogen™ Supplier No. RP99311

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111330 (PA5-111330. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control. The DCX(TRUSS) complex specifically mediates the polyubiquitination and subsequent degradation of MYC. Also participates in the activation of NFKB1 in response to ligation of TNFRSF1A, possibly by linking TNFRSF1A to the IKK signalosome. Involved in JNK activation via its interaction with TRAF2. Also involved in elevation of endoplasmic reticulum Ca(2+) storage reduction in response to CHRM1.

Specifications

Accession Number Q8TEL6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26133
Name Human TRPC4AP (aa 427-511) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4833429F06Rik; C20orf188; D2Ertd113e; hypothetical protein; mFLJ00177; PPP1R158; protein phosphatase 1, regulatory subunit 158; Protein TAP1; Protein TRUSS; Rabex-5/Rin2-interacting protein; short transient receptor potential channel 4 associated protein; short transient receptor potential channel 4-associated protein; TAP1 protein; TNF-receptor; TNF-receptor ubiquitous scaffolding/signaling protein; TP4AP; transient receptor potential cation channel subfamily C member 4 associated protein; transient receptor potential cation channel, subfamily C, member 4 associated protein; transient receptor protein 4, associated protein; TRP4-associated protein; Trp4-associated protein TAP1; Trpc4ap; trpc4-associated protein; Trrp4ap; TRUSS; tumor necrosis factor receptor-associated ubiquitous scaffolding and signaling protein
Common Name TRPC4AP
Gene Symbol TRPC4AP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less