missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRMT1L (aa 574-671) Control Fragment Recombinant Protein

Catalog No. RP94154
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94154 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94154 Supplier Invitrogen™ Supplier No. RP94154
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55397 (PA5-55397. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that has some similarity to N2,N2-dimethylguanosine tRNA methyltransferase from other organisms. Studies of the mouse ortholog have shown that this protein plays a role in motor coordination and exploratory behavior, and it may also be involved in modulating postnatal neuronal functions. Alternatively spliced transcripts have been identified for this gene.

Specifications

Accession Number Q7Z2T5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 81627
Name Human TRMT1L (aa 574-671) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1190005F20Rik; AW226554; bG120K12.3; C1orf25; MST070; MSTP070; RGD1307890; TRM1 tRNA methyltransferase 1-like; TRM1L; Trm1-like; TRM1-like protein; TRMT1L; TRMT1-like protein; tRNA methyltransferase 1 homolog (S. cerevisiae)-like; tRNA methyltransferase 1 homolog-like; tRNA methyltransferase 1 like; tRNA methyltransferase 1-like
Common Name TRMT1L
Gene Symbol Trmt1l
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QFSIHASSNVNKQEENGVFIKTTDDTTTDNYIAQGKRKSNEMITNLGKKQKTDVSTEHPPFYYNIHRHSIKGMNMPKLKKFLCYLSQAGFRVSRTHFD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less