missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRK fused gene (aa 308-396) Control Fragment Recombinant Protein

Catalog No. RP92560
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92560 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92560 Supplier Invitrogen™ Supplier No. RP92560

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53996. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TFG protein, a recently identified novel protein, is a human homolog of mouse TFG protein. It contains an N-terminal coiled-coil structure, a SPYGQ-rich region followed by octicosapeptide repeats. Research shows that TFG can modulate SHP-1 activity and is a novel member of the NF-kB pathway. The physiological functions of this protein remain largely elusive, but TFG is thought to function by associating with other proteins, including TANK and NEMO. TFG was first identified as a partner of NTRK1 and is involved in generating the thyroid TRK-T3 oncogene, as well as oncogenic rearrangements with ALK in anaplastic lymphoma and NOR1 in mixoid chondrosarcoma.

Specifications

Accession Number Q92734
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 10342
Name Human TRK fused gene (aa 308-396) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AI173908; HMSNP; protein TFG; SPG57; TF6; TFG; Trk-fused gene; TRK-fused gene protein; TRKT3; TRKT3 oncogene
Common Name TRK fused gene
Gene Symbol TFG
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less