missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP93190

Invitrogen™ Human TRIM37 (aa 620-744) Control Fragment Recombinant Protein

Catalog No. RP93190
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93190 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93190 Supplier Invitrogen™ Supplier No. RP93190

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82779 (PA5-82779. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1, 4, 5, -trisphosphate (PIP). PI4KB may regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation.

Specifications

Accession Number O94972
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4591
Name Human TRIM37 (aa 620-744) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110032A10Rik; 2810004E07Rik; AI848587; AU043018; E3 ubiquitin-protein ligase TRIM37; Kiaa0898; mKIAA0898; MUL; mulibrey nanism protein; POB1; RING-B-box-coiled-coil protein; RING-type E3 ubiquitin transferase TRIM37; TEF3; TRAF encompassing factor 3; Trim37; tripartite motif containing 37; tripartite motif protein 37; tripartite motif-containing 37; tripartite motif-containing protein 37
Common Name TRIM37
Gene Symbol TRIM37
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IHLLDLKDRSSIENLWGLQPRPPASLLQPTASYSRKDKDQRKQQAMWRVPSDLKMLKRLKTQMAEVRCMKTDVKNTLSEIKSSSAASGDMQTSLFSADQAALAACGTENSGRLQDLGMELLAKSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less