missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRIM2 (aa 162-235) Control Fragment Recombinant Protein

Catalog No. RP96624
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96624 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96624 Supplier Invitrogen™ Supplier No. RP96624

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57431 (PA5-57431. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic filaments. Its function has not been identified.

Specifications

Accession Number Q9C040
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23321
Name Human TRIM2 (aa 162-235) Control Fragment
Quantity 100 μL
Gene Alias CMT2R; E3 ubiquitin-protein ligase TRIM2; KIAA0517; mKIAA0517; narf; Neural activity-related RING finger protein; RING finger protein 86; RING-type E3 ubiquitin transferase TRIM2; RNF86; TRIM2; tripartite motif containing 2; tripartite motif protein 2; tripartite motif protein TRIM2; tripartite motif-containing 2; tripartite motif-containing protein 2
Common Name TRIM2
Gene Symbol Trim2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less