missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105780

Invitrogen™ Human TREF1 (aa 719-834) Control Fragment Recombinant Protein

Catalog No. RP105780
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105780 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105780 Supplier Invitrogen™ Supplier No. RP105780
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TREF1 encodes a zinc-finger transcriptional regulating protein which interacts with CBP/p300 to regulate the human gene CYP11A1.

Specifications

Accession Number Q96PN7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55809
Name Human TREF1 (aa 719-834) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9430096I18Rik; AI429294; B830015H24; BCAR2; Breast cancer anti-estrogen resistance 2; dJ139D8.5; HSA277276; RAPA; rapa-1; rapa-2; RP1-139D8.5; transcriptional regulating factor 1; transcriptional regulating protein 132; transcriptional-regulating factor 1; Transcriptional-regulating protein 132; Trep132; Trep-132; TRERF1; Zinc finger protein rapa; zinc finger transcription factor TReP-132
Common Name TREF1
Gene Symbol TRERF1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QGSGLFSNVLISGHGPGAHPQLPLTPLTPTPRVLLCRSNSIDGSNVTVTPGPGEQTVDVEPRINIGLRFQAEIPELQDISALAQDTHKATLVWKPWPELENHDLQQRVENLLNLCC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less