missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101324

Invitrogen™ Human TRBP (aa 67-132) Control Fragment Recombinant Protein

Catalog No. RP101324
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101324 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101324 Supplier Invitrogen™ Supplier No. RP101324

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84053 (PA5-84053. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRBP belongs to the family of dsRNA-binding proteins. It consists of highly conserved 2 dsRNA-binding domains and C-terminal basic region. It is a unique cellular protein capable of binding to HIV-TAR RNA and stimulates expression of HIV-1 long terminal repeats. It also inhibits the host antiviral and anti-proliferative mechanisms by directly binding to IFN-regulated dsRNA-dependent protein kinase (PKR). TRBP associates with Ago2 protein and forms an integral component of Dicer-containing complex. It has a role in micro RNA processing and in RISC assembly. Other functions of TRBP include promoting cellular growth and tumorigenesis.

Specifications

Accession Number Q15633
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6895
Name Human TRBP (aa 67-132) Control Fragment
Quantity 100 μL
Gene Alias fj51e12; HAMAP-Rule:MF_03034}; LOQS; Prbp; PRM-1 RNA-binding protein; protamine-1 RNA-binding protein; RISC-loading complex subunit tarbp2; RISC-loading complex subunit TARBP2 {ECO:0000255; TAR (HIV) RNA binding protein 2; TAR (HIV) RNA-binding protein 2; TAR (HIV) RNA-binding protein TRBP1; TAR (HIV-1) RNA binding protein 2; TAR RNA binding protein 2; TAR RNA-binding protein 2; TARBP2; TARBP2 subunit of RISC loading complex; TARBP2, RISC loading complex RNA binding subunit; trans-activation responsive RNA-binding protein; trans-activation-responsive RNA-binding protein; TRBP; TRBP1; TRBP2; wu:fj51e12; zgc:63778
Common Name TRBP
Gene Symbol TARBP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPEDIPVFTAAAAAT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less