missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TPST1 (aa 333-370) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP108462
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84519 (PA5-84519. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The tyrosylprotein sulfotransferases TPST-1 and TPST-2 catalyze the sulfation of tyrosine residues within secreted and membrane-bound proteins, such as cell adhesion molecules, G-protein-coupled receptors, coagulation factors, serpins, extracellular matrix proteins, and hormones. Although both TPST-1 and TPST-2 utilize 3'-phosphoadenosine 5'-phosphosulfate as their sulfate donor, they differ in their substrate specificity.Specifications
| O60507 | |
| Blocking Assay, Control | |
| 8460 | |
| 100 μL | |
| Protein-tyrosine sulfotransferase 1; R75054; TANGO13A; Tpst1; TPST-1; transport and golgi organization 13 homolog A; tyrosylprotein sulfotransferase 1; tyrosylprotein sulfotransferase-1 | |
| TPST1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TPST1 (aa 333-370) Control Fragment | |
| RUO | |
| TPST1 | |
| Unconjugated | |
| Recombinant | |
| PNYGKPDPKIIENTRRVYKGEFQLPDFLKEKPQTEQVE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |