missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TOX2 (aa 97-162) Control Fragment Recombinant Protein

Catalog No. RP106852
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106852 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106852 Supplier Invitrogen™ Supplier No. RP106852

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84378 (PA5-84378. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TOX2 (TOX High Mobility Group Box Family Member 2) is a Protein Coding gene. Diseases associated with TOX2 include Conduct Disorder. Gene Ontology (GO) annotations related to this gene include chromatin binding and RNA polymerase II transcription factor binding. An important paralog of this gene is TOX.

Specifications

Accession Number Q96NM4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84969
Name Human TOX2 (aa 97-162) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI851523; AV026525; BI987407; C20orf100; dJ1108D11.2; dJ495O3.1; GCX1; Gcx-1; granulosa cell HMG box 1; granulosa cell HMG box protein 1; granulosa cell HMG-box protein 1; granulosa cell HMG-box protein-1; LOW QUALITY PROTEIN: TOX high mobility group box family member 2; RxHMG1; TOX high mobility group box family member 2; TOX2
Common Name TOX2
Gene Symbol TOX2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less