missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP107024

Invitrogen™ Human TOPORS Control Fragment Recombinant Protein

Catalog No. RP107024
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107024 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107024 Supplier Invitrogen™ Supplier No. RP107024

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66342 (PA5-66342. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Functions as an E3 ubiquitin-protein ligase and as an E3 SUMO1-protein ligase. Probable tumor suppressor involved in cell growth, cell proliferation and apoptosis that regulates p53/TP53 stability through ubiquitin-dependent degradation. May regulate chromatin modification through sumoylation of several chromatin modification-associated proteins. May be involved in DNA damage-induced cell death through IKBKE sumoylation.

Specifications

Accession Number Q9NS56
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10210
Name Human TOPORS Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW105885; E3 ubiquitin-protein ligase Topors; LUN; p53-binding protein 3; P53BP3; p53BP3/LUN; RING-type E3 ubiquitin transferase Topors; RP31; SUMO1-protein E3 ligase Topors; TOP1 binding arginine/serine rich protein; topoisomerase 1-binding RING finger; topoisomerase I binding, arginine/serine-rich; topoisomerase I binding, arginine/serine-rich, E3 ubiquitin protein ligase; topoisomerase I-binding arginine/serine-rich protein; Topoisomerase I-binding RING finger protein; Topors; TP53BPL; tumor suppressor p53-binding protein 3
Common Name TOPORS
Gene Symbol TOPORS
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GGATCQIQGVQTNDDLNNDSDDSSDNCVIVGFVKPLAERTPELVELSSDSEDLGSYEKMETVKTQEQEQSYSSGDSDVSRCSSPHSVLGKDEQINKGHCDSSTRIKSKKEEKRSTSLSSPRNL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less