missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TOB1 (aa 189-243) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP106155
Description
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65480 (PA5-65480. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the tob/btg1 family of anti-proliferative proteins that have the potential to regulate cell growth. When exogenously expressed, this protein supresses cell growth in tissue culture. The protein undergoes phophorylation by a serine/threonine kinase, 90 kDa ribosomal S6 kinase. Interactions of this protein with the v-erb-b2 erythroblastic leukemia viral oncogene homolog 2 gene product p185 interferes with growth suppression. This protein inhibits T cell proliferation and transcription of cytokines and cyclins. The protein interacts with both mothers against decapentaplegic Drosophila homolog 2 and 4 to enhance their DNA binding activity. This interaction inhibits interleukin 2 transcription in T cells.Specifications
| P50616 | |
| Blocking Assay, Control | |
| 10140 | |
| 100 μL | |
| APRO5; APRO6; MGC104792; MGC34446; PIG49; proliferation-inducing gene 49; protein Tob1; Protein Tob1-like protein; TOB; TOB1; transducer of erbB2; Transducer of erbB-2 1; transducer of ERBB2, 1; transducer of ErbB-2.1; Trob; TROB1; Unknown (protein for MGC:134447) | |
| TOB1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TOB1 (aa 189-243) Control Fragment | |
| RUO | |
| TOB1 | |
| Unconjugated | |
| Recombinant | |
| STKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQ | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |