missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TNMD (aa 252-302) Control Fragment Recombinant Protein

Catalog No. RP95418
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95418 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95418 Supplier Invitrogen™ Supplier No. RP95418
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57096 (PA5-57096. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.

Specifications

Accession Number Q9H2S6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64102
Name Human TNMD (aa 252-302) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110017I01Rik; Bricd4; BRICHOS domain containing 4; ChM1L; Chondromodulin-1-like protein; chondromodulin-IB; chondromodulin-I-like protein; hChM1L; hTeM; mChM1L; mTeM; myodulin; rChM1L; rTeM; teM; Tendin; tenomodulin; TNMD; UNQ771/PRO1565; zgc:172161
Common Name TNMD
Gene Symbol TNMD
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less