missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP102318

Invitrogen™ Human TNFR1 (aa 35-182) Control Fragment Recombinant Protein

Catalog No. RP102318
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102318 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102318 Supplier Invitrogen™ Supplier No. RP102318

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TNFR1 (Tumor necrosis factor receptor 1) belongs to the tumor necrosis factor superfamily, and is one of the major TNF-alpha receptors. TNFR1 plays an important role in mediating, in cytokine mediated signaling, positive regulation of the NF-Kb pathway, positive regulation of angiogenesis, and negative regulation of gene expression. The extracellular domain of TNFR1 is also released into the circulatory system as soluble TNFR1 (sTNFR1). In humans, the TNFR1 gene is located on chromosome 12. Anti-apoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with TNFR1, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of TNFR1 were found to be associated with the autosomal dominant periodic fever syndrome, and the impaired receptor clearance is thought to be a mechanism of the disease.

Specifications

Accession Number P19438
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7132
Name Human TNFR1 (aa 35-182) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CD120a; CD120a antigen; FPF; hypothetical protein; metalloproteinase inhibitor 4; MGC19588; MS5; n-smase activation assoc. factor; p55; p55 TNF receptor; p55-R; p60; p62; p63; sCD120a; soluble CD120a; soluble TNFR1; sTNF RI; sTNFR I; sTNFR1; sTNFRI; TBP1; TBPI; TIMP metallopeptidase inhibitor 4; Timp4; TIMP-4; tissue inhibitor of metalloproteinase 4; tissue inhibitor of metalloproteinases 4; TNF receptor alpha chain; TNF receptor superfamily member 1 A; TNF-alphaR1; TNF-alpha-R1; TNFalpha-R1; TNFAR; TNFR; TNF-R; TNFR I; TNFR1; TNF-R1; Tnfr-1; TNFR1-d2; Tnfr-2; TNFR55; TNF-R55; TNFR60; TNFRI; TNF-RI; TNF-R-I; TNFR-I; TNFRp55; Tnfrsf1a; tumor necrosis factor binding protein 1; Tumor necrosis factor receptor; tumor necrosis factor receptor 1; tumor necrosis factor receptor 1 A isoform beta; tumor necrosis factor receptor superfamily member 1 A; Tumor necrosis factor receptor superfamily member 1 A, membrane form; tumor necrosis factor receptor superfamily, member 1 A; tumor necrosis factor receptor type 1; tumor necrosis factor receptor type I; tumor necrosis factor-alpha receptor; Tumor necrosis factor-binding protein 1
Common Name TNFR1
Gene Symbol Tnfrsf1a
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less