missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90725

Invitrogen™ Human TNFAIP1 (aa 80-170) Control Fragment Recombinant Protein

Catalog No. RP90725
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90725 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90725 Supplier Invitrogen™ Supplier No. RP90725

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53043 (PA5-53043. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. Studies of a similar gene in mouse suggest that the expression of this gene is developmentally regulated in a tissue-specific manner.

Specifications

Accession Number Q13829
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7126
Name Human TNFAIP1 (aa 80-170) Control Fragment
Quantity 100 μL
Gene Alias B12; B61; BACURD2; BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2; BTB/POZ domain-containing protein TNFAIP1; BTBD34; EDP1; Edp-1; hBACURD2; Protein B12; TNF alpha induced protein 1; Tnfaip1; Tnfip1; tumor necrosis factor induced protein 1; tumor necrosis factor, alpha induced protein 1; tumor necrosis factor, alpha-induced protein 1 (endothelial); Tumor necrosis factor, alpha-induced protein 1, endothelial; Tumor necrosis factor-induced protein 1
Common Name TNFAIP1
Gene Symbol TNFAIP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less