missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TMEM38B (aa 236-282) Control Fragment Recombinant Protein

Catalog No. RP91197
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91197 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91197 Supplier Invitrogen™ Supplier No. RP91197
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53809 (PA5-53809. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMEM38A and TMEM38B are two recently identified trimeric intracellular cation (TRIC) channel subtypes. TMEM38B is expressed in most mammalian tissues, while TMEM38A is preferentially expressed in excitable tissues such as striated muscle and brain. Mice deficient in both TMEM38A and TMEM38B suffer embryonic cardiac failure; the cardiac myocytes display severe dysfunction in SR Ca2+ handling, weakened Ca2+ release, and reduced K+ permeability indicating that the TRIC cation channels are likely to act as counter-ion channels that function in synchronization with Ca2+ release from intracellular stores. Mice that were lacking only TMEM38B however, die shortly after birth due to respiratory failure and have lungs exhibiting severe histological defect and ultrastructural abnormalities in their alveolar type II epithelial cells, indicating that TMEM38B are essential for perinatal lung maturation. Other experiments have shown that TMEM38A and TMEM38B can act with junctophilin proteins to support efficient ryanodine receptor-mediated Ca2+ release in muscle cells.

Specifications

Accession Number Q9NVV0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55151
Name Human TMEM38B (aa 236-282) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1600017F22Rik; AA437809; AV051057; bA219P18.1; C9orf87; D4Ertd89e; mg33b; Mitsugumin33B; Mitsugumin-33 B; OI14; RGD1305703; RP11-219P18.1; TMEM38B; Transmembrane protein 38 B; TRICB; TRIC-B; trimeric intracellular cation channel type B
Common Name TMEM38B
Gene Symbol TMEM38B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less