missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TMEM237 (aa 138-210) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101392
Description
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62647 (PA5-62647. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a tetraspanin protein that is thought to be involved in WNT signaling. Defects in this gene are a cause of Joubert syndrome-14. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012].Specifications
| Q96Q45 | |
| Blocking Assay, Control | |
| 65062 | |
| 100 μL | |
| AI853305; Als2cr4; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 4; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein homolog; Gm972; JBTS14; Tmem237; Transmembrane protein 237 | |
| TMEM237 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TMEM237 (aa 138-210) Control Fragment | |
| RUO | |
| TMEM237 | |
| Unconjugated | |
| Recombinant | |
| ELQYANELGVEDEDIITDEQTTVEQQSVFTAPTGISQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |