missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TMEM168 (aa 457-531) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109616
Description
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139951 (PA5-139951. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
TMEM168 is a multi-pass membrane protein. It belongs to the TMEM168 family. The exact function of TMEM168 remains unknown.Specifications
| Q9H0V1 | |
| Blocking Assay, Control | |
| 64418 | |
| 100 μL | |
| 5730526F17Rik; 8430437G11Rik; AI462344; AI504145; RGD1307778; Tmem168; Transmembrane protein 168 | |
| TMEM168 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TMEM168 (aa 457-531) Control Fragment | |
| RUO | |
| TMEM168 | |
| Unconjugated | |
| Recombinant | |
| YHMIETYGCDYSTSGLSFDTLHSKLKAFLELRTVDGPRHDTYILYYSGHTHGTGEWALAGGDTLRLDTLIEWWRE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |