missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91096

Invitrogen™ Human TMEM150A (aa 27-73) Control Fragment Recombinant Protein

Catalog No. RP91096
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91096 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91096 Supplier Invitrogen™ Supplier No. RP91096

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53892 (PA5-53892. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

T150A is possible role in fasting-induced catabolism. Classified as a membrane-integrated protein with six transmembrane domains; may play a role in fasting-induced catabolism.

Specifications

Accession Number Q86TG1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 129303
Name Human TMEM150A (aa 27-73) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias fasting-inducible integral membrane protein TM6P1; t150a; TM6P1; TMEM150; TMEM150A; Transmembrane protein 150; transmembrane protein 150 A
Common Name TMEM150A
Gene Symbol TMEM150A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLDDVPLISKCGSYP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less