missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TMC7 (aa 27-143) Control Fragment Recombinant Protein

Catalog No. RP90832
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90832 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90832 Supplier Invitrogen™ Supplier No. RP90832
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56158 (PA5-56158. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMC7 (Transmembrane channel-like protein 7) is a 723 amino acid protein that is a member of the TMC protein family. All TMC genes encode transmembrane proteins with intracellular amino- and carboxy- termini and at least eight membrane spanning domains. Therefore, TMC7 is a multi-pass membrane protein that may regulate or function as an ion channel or transporter. The gene encoding TMC7 maps to human chromosome 16, which encodes over 900 genes and comprises nearly 3% of the human genome. The GAN gene is located on chromosome 16 and, with mutation, may lead to giant axonal neuropathy, a nervous system disorder characterized by increasing malfunction with growth. The rare disorder Rubinstein-Taybi syndrome is also associated with chromosome 16, as is Crohn's disease, which is a gastrointestinal inflammatory condition.

Specifications

Accession Number Q7Z402
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79905
Name Human TMC7 (aa 27-143) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700030H01Rik; C230064B05; C630024K23Rik; RGD1564267; Tmc7; transmembrane channel like 7; transmembrane channel-like 7; transmembrane channel-like gene family 7; transmembrane channel-like protein 7
Common Name TMC7
Gene Symbol TMC7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LDSSCFSSPPVNFLQELPSYRSIARRRTTVHSRDKQSGTLLKPTDSYSSQLEDRIAENLSSHSLRNYALNISEKRRLRDIQETQMKYLSEWDQWKRYSSKSWKRFLEKAREMTTHLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less