missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101332

Invitrogen™ Human TMC6 (aa 101-184) Control Fragment Recombinant Protein

Catalog No. RP101332
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101332 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101332 Supplier Invitrogen™ Supplier No. RP101332
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111336 (PA5-111336. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMC6 interacts with, and forms a complex with the zinc transporter 1, SLC30A1, and localizes to the endoplasmic reticulum, nuclear membrane and Golgi apparatus. The inactivation of the TMC6 gene has been implicated in the skin disorder epidermodysplasia verruciformis (EV), an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in either of two adjacent genes located on chromosome 17q25.3. TMC6 encodes integral membrane proteins that localize to the endoplasmic reticulum and are predicted to form transmembrane channels. This gene encodes a transmembrane channel-like protein with 10 transmembrane domains and 2 leucine zipper motifs. Diseases associated with TMC6 include Epidermodysplasia Verruciformis and Superficial Mycosis.

Specifications

Accession Number Q7Z403
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11322
Name Human TMC6 (aa 101-184) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D11Ertd204e; epidermodysplasia verruciformis 1; epidermodysplasia verruciformis protein 1; EV1; EVER1; EVIN1; expressed in activated T/LAK lymphocytes; LAK-4 P; protein LAK-4; Tmc6; transmembrane channel like 6; transmembrane channel-like gene family 6; transmembrane channel-like protein 6
Common Name TMC6
Gene Symbol TMC6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YYNRTVQLRCRSSRPLLGNFVRSAWPSLRLYDLELDPTALEEEEKQSLLVKELQSLAVAQRDHMLRGMPLSLAEKRSLREKSRT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less