missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101155

Invitrogen™ Human TM9SF1 (aa 259-301) Control Fragment Recombinant Protein

Catalog No. RP101155
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101155 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101155 Supplier Invitrogen™ Supplier No. RP101155

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84406 (PA5-84406. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays an essential role in autophagy.

Specifications

Accession Number O15321
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10548
Name Human TM9SF1 (aa 259-301) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200014D02Rik; AI893436; fa03b09; HMP70; MP70; MP70 protein family member; multispanning membrane protein (70 kD); TM9SF1; Transmembrane 9 superfamily member 1; transmembrane protein 9 superfamily member 1; wu:fa03b09; zgc:100810
Common Name TM9SF1
Gene Symbol TM9SF1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less