missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TM2D3 (aa 61-149) Control Fragment Recombinant Protein

Catalog No. RP101548
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101548 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101548 Supplier Invitrogen™ Supplier No. RP101548

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62910 (PA5-62910. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily. This protein has sequence and structural similarities to the beta-amyloid binding protein (BBP), but, unlike BBP, it does not regulate a response to beta-amyloid peptide. This protein may have regulatory roles in cell death or proliferation signal cascades. Several alternatively spliced transcript variants of this gene are described but the full length nature of some variants has not been determined. Multiple polyadenylation sites have been found in this gene.

Specifications

Accession Number Q9BRN9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80213
Name Human TM2D3 (aa 61-149) Control Fragment
Quantity 100 μL
Gene Alias 1110025I09Rik; 5930422O05Rik; BBP-like protein 2; beta-amyloid-binding protein-like protein 2; Blp2; fc17h12; LOW QUALITY PROTEIN: TM2 domain-containing protein 3; RGD1564929; TM2 domain containing 3; TM2 domain-containing protein 3; tm2d3; wu:fc17h12; ZFOS-508H5.2; zgc:165591
Common Name TM2D3
Gene Symbol TM2D3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IPPYVMKCPSNGLCSRLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less