missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TL1A (aa 58-152) Control Fragment Recombinant Protein

Catalog No. RP106123
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106123 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106123 Supplier Invitrogen™ Supplier No. RP106123
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. An additional isoform encoded by an alternatively spliced transcript variant has been reported but the sequence of this transcript has not been determined.

Specifications

Accession Number O95150
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9966
Name Human TL1A (aa 58-152) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias bM20K13.3 (tumor necrosis factor (ligand) superfamily, member 15); MGC129934; MGC129935; TL1; TL1A; TNF ligand-related molecule 1; TNF superfamily ligand TL1A; TNFSF15; TNLG1B; tumor necrosis factor (ligand) superfamily member 15; tumor necrosis factor (ligand) superfamily, member 15; tumor necrosis factor ligand 1 B; tumor necrosis factor ligand superfamily member 15; Tumor necrosis factor ligand superfamily member 15, membrane form; Tumor necrosis factor ligand superfamily member 15, secreted form; tumor necrosis factor superfamily member 15; vascular endothelial cell growth inhibitor; vascular endothelial growth inhibitor; vascular endothelial growth inhibitor-192 A; Vegi; VEGI192A
Common Name TL1A
Gene Symbol TNFSF15
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less