missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94866

Invitrogen™ Human TJAP1 (aa 299-400) Control Fragment Recombinant Protein

Catalog No. RP94866
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94866 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94866 Supplier Invitrogen™ Supplier No. RP94866
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56376 (PA5-56376. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a tight junction-associated protein. Incorporation of the encoded protein into tight junctions occurs at a late stage of formation of the junctions. The encoded protein localizes to the Golgi and may function in vesicle trafficking. Alternatively spliced transcript variants have been described. A related pseudogene exists on the X chromosome.

Specifications

Accession Number Q5JTD0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 93643
Name Human TJAP1 (aa 299-400) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610041D19Rik; AI415281; AW121008; hdlg-binding protein Pilt; Pilt; Protein incorporated later into tight junctions; sb:eu465; si:dkey-109m21.1; tight junction associated protein 1; tight junction associated protein 1 (peripheral); tight junction associated protein 1 (peripheral) isoform 1; tight junction associated protein 1 (peripheral) isoform 2; Tight junction protein 4; tight junction protein 4 (peripheral); tight junction-associated protein 1; TJAP1; TJP4
Common Name TJAP1
Gene Symbol TJAP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSPEEELPLPAFEKLNPYPTPSPPHPLYPGRRVIEFSEDKVRIPRNSPLPNCTYATRQAISLSLVEEGSERARPSPVPSTPASAQASPHHQPSPAPLTLSAP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less