missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human THAP9 (aa 701-784) Control Fragment Recombinant Protein

Catalog No. RP96725
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96725 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96725 Supplier Invitrogen™ Supplier No. RP96725

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (23%), Rat (23%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57947 (PA5-57947. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

THAP9 (THAP domain-containing protein 9) is a 903 amino acid protein that contains one THAP-type zinc finger. The gene that encodes THAP9 contains roughly 19,448 bases and maps to human chromosome 4q21.22. Chromosome 4 represents approximately 6% of the human genome and contains nearly 900 genes. Notably, the Huntingtin gene, which is found to encode an expanded glutamine tract in cases of Huntington's disease, is on chromosome 4. FGFR-3 is also encoded on chromosome 4 and has been associated with thanatophoric dwarfism, achondroplasia, Muenke syndrome and bladder cancer. Chromosome 4 is also tied to Ellis-van Creveld syndrome, methylmalonic acidemia and polycystic kidney disease.

Specifications

Accession Number Q9H5L6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79725
Name Human THAP9 (aa 701-784) Control Fragment
Quantity 100 μL
Gene Alias DNA transposase THAP9; hTh9; THAP domain containing 9; THAP domain-containing protein 9; THAP9
Common Name THAP9
Gene Symbol THAP9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LSEALLDLSDHRRNLICYAGYVANKLSALLTCEDCITALYASDLKASKIGSLLFVKKKNGLHFPSESLCRVINICERVVRTHSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less