missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TGFBR3L (aa 25-75) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP107989
Description
Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67340 (PA5-67340. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
TGFBR3L is a protein coding gene.Specifications
| H3BV60 | |
| Blocking Assay, Control | |
| 100507588 | |
| 100 μL | |
| TGF-beta receptor type III-like protein; TGF-beta receptor type-3-like protein; TGFBR3L; TGFR-3 L; transforming growth factor beta receptor 3 like; transforming growth factor beta receptor III like; transforming growth factor, beta receptor III-like; transforming growth factor-beta receptor type 3-like protein; Transforming growth factor-beta receptor type III-like protein | |
| TGFBR3L | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TGFBR3L (aa 25-75) Control Fragment | |
| RUO | |
| TGFBR3L | |
| Unconjugated | |
| Recombinant | |
| FPGGLKGSARFLSFGPPFPAPPAPPFPAAPGPWLRRPLFSLKLSDTEDVFP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |