missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95295

Invitrogen™ Human TFF2 (aa 36-118) Control Fragment Recombinant Protein

Catalog No. RP95295
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95295 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95295 Supplier Invitrogen™ Supplier No. RP95295

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57781 (PA5-57781. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Trefoil peptides are protease resistant molecules secreted throughout the gut that play a role in mucosal healing and protection of the gastrointestinal epithelia. These peptides contain three intrachain disulfide bonds, forming the trefoil motif, or P-domain. SP (spasmolytic polypeptide), also designated Trefoil factor 2 (TFF2) precursor, is a trefoil protein that functions to inhibit gastrointestinal motility and gastric acid secretion. SP may also act as a structural component of the gastric mucus, possibly by stabilizing glycoproteins in the mucus gel through interactions with carbohydrate side chains. A downregulation of SP expression is associated with primary gastric cancer, and a progressive loss of this protein is likely to be involved in the early stage of the multi-step gastric carcinogenesis pathway.

Specifications

Accession Number Q03403
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7032
Name Human TFF2 (aa 36-118) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias mSP; pancreatic spasmolytic polypeptide; PSP; SML1; SP; spasmolysin; Spasmolytic polypeptide; spasmolytic protein 1; Tff2; Trefoil factor 2; trefoil factor 2 (spasmolytic protein 1)
Common Name TFF2
Gene Symbol Tff2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less