missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP100693

Invitrogen™ Human TFAP4 (aa 3-147) Control Fragment Recombinant Protein

Catalog No. RP100693
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100693 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100693 Supplier Invitrogen™ Supplier No. RP100693

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51658 (PA5-51658. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcription factors of the basic helix-loop-helix-zipper(bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG.

Specifications

Accession Number Q01664
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7023
Name Human TFAP4 (aa 3-147) Control Fragment
Quantity 100 μL
Gene Alias Activating enhancer-binding protein 4; AI642933; AP4; AP-4; bHLHc41; Class C basic helix-loop-helix protein 41; D930048N17Rik; LOW QUALITY PROTEIN: transcription factor AP-4; Tcfap4; TFAP4; transcription factor AP4; Transcription factor AP-4; transcription factor AP-4 (activating enhancer binding protein 4); transcription factor AP-4 (activating enhancer-binding protein 4)
Common Name TFAP4
Gene Symbol Tfap4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less