missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91314

Invitrogen™ Human TET3 (aa 1204-1322) Control Fragment Recombinant Protein

Catalog No. RP91314
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91314 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91314 Supplier Invitrogen™ Supplier No. RP91314
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62255 (PA5-62255. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TET3, a member of the ten-eleven-translocation (TET) family of genes, is a methylcytosine dioxygenase that catalyzes the conversion of methylcytosine to 5-hydroxymethylcytosine and is most abundantly expressed in hematopoietic cells. Unlike the related TET2 protein, mutations in TET3 have not been observed in any myeloid malignancies. TET3 has been shown to be involved in the demethylation of zygotic DNA before the first mitosis and has been suggested to be involved in the epigenetic reprogramming of the zygotic paternal DNA following natural fertilization and may also contribute to somatic cell nuclear reprogramming during animal cloning.

Specifications

Accession Number O43151
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 200424
Name Human TET3 (aa 1204-1322) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B430006D22Rik; BC037432; D230004J03Rik; hCG_40738; KIAA0401; Methylcytosine dioxygenase TET3; MGC22014; probable methylcytosine dioxygenase TET3; putative methylcytosine dioxygenase; Tet methylcytosine deoxygenase 3 isoform; tet methylcytosine dioxygenase 3; tet oncogene family member 3; Tet3
Common Name TET3
Gene Symbol TET3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less