missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP103240

Invitrogen™ Human Tensin 3 (aa 647-731) Control Fragment Recombinant Protein

Catalog No. RP103240
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103240 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103240 Supplier Invitrogen™ Supplier No. RP103240

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63238 (PA5-63238. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Tensin (Tns) family of proteins is involved in the maintenance of cellular structure by anchoring actin filaments at the focal adhesion via F-actin binding and capping activities. Tns proteins also contain a Src homology 2 (SH2) domain and have the ability to be phosphorylated, suggesting a role in signal transduction cascades. These diverse characteristics indicate that Tns proteins may be important links between the cytoskeleton and signal transduction pathways. Tns3, also known as TEM6 or TENS1, localizes to the focal adhesions of the plasma membrane. It is predominantly expressed in thyroid and placenta but can also be found in heart, liver, brain, prostate, pancreas, kidney, lung, skeletal muscle and white blood cells. Tns3 is essential for proper growth and development, as suggested by growth retardation and death in a number of Tns3-/- mice.

Specifications

Accession Number Q68CZ2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64759
Name Human Tensin 3 (aa 647-731) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC023928; F830010I22Rik; RGD1564174; TEM6; TENS1; TENS3; tensin 3; tensin3; tensin-3; tensin-3-like; tensin-like SH2 domain containing 1; tensin-like SH2 domain-containing 1; tensin-like SH2 domain-containing protein 1; thyroid specific PTB domain protein; TNS3; TPP; TSN3; tumor endothelial marker 6
Common Name Tensin 3
Gene Symbol Tns3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VGSGPHPPDTQQPSPSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNALGSQANGSV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less