missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TENC1 (aa 1035-1129) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP96517
Description
Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57006 (PA5-57006. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Regulates cell motility and proliferation. May have phosphatase activity. Reduces AKT1 phosphorylation. Lowers AKT1 kinase activity and interferes with AKT1 signaling.Specifications
| Q63HR2 | |
| Blocking Assay, Control | |
| 23371 | |
| 100 μL | |
| C1 domain-containing phosphatase and tensin homolog; C1 domain-containing phosphatase and tensin-like protein; C1TEN; C1-ten; KIAA1075; nep; nph; Tenc1; tensin 2; tensin like C1 domain containing phosphatase (tensin 2); tensin like C1 domain-containing phosphatase; tensin-2; Tensin-like C1 domain-containing phosphatase; Tns2 | |
| TNS2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TENC1 (aa 1035-1129) Control Fragment | |
| RUO | |
| TENC1 | |
| Unconjugated | |
| Recombinant | |
| VPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLPGPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSN | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |