missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TENC1 (aa 1035-1129) Control Fragment Recombinant Protein

Catalog No. RP96517
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96517 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96517 Supplier Invitrogen™ Supplier No. RP96517

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57006 (PA5-57006. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulates cell motility and proliferation. May have phosphatase activity. Reduces AKT1 phosphorylation. Lowers AKT1 kinase activity and interferes with AKT1 signaling.

Specifications

Accession Number Q63HR2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23371
Name Human TENC1 (aa 1035-1129) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C1 domain-containing phosphatase and tensin homolog; C1 domain-containing phosphatase and tensin-like protein; C1TEN; C1-ten; KIAA1075; nep; nph; Tenc1; tensin 2; tensin like C1 domain containing phosphatase (tensin 2); tensin like C1 domain-containing phosphatase; tensin-2; Tensin-like C1 domain-containing phosphatase; Tns2
Common Name TENC1
Gene Symbol TNS2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLPGPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less